SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000682 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000682
Domain Number 1 Region: 273-339
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.6e-22
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 2 Region: 215-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000106
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 153-209
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 90-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000113
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 27-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000111
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000682   Gene: ENSLAFG00000000817   Transcript: ENSLAFT00000000817
Sequence length 343
Comment pep:novel supercontig:loxAfr3:scaffold_16:502518:514793:-1 gene:ENSLAFG00000000817 transcript:ENSLAFT00000000817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSSNMLFLINVLLTLWVSCAEGQERTCNFPEIKHGKTYGENQPKRTFPVAMGKYLYYTC
DHSYLSASQSLWTRITCTEEGWSPIPKCRRQCFFPSVENGHSSSSGQIHLEGDTVQILCD
TGYKLANDQSSITCMEDDWSSPPKCSTADSGGKCGPPPPIENGDIISFPLPTYTQGSTVE
YQCWVFYELKGDKHITCRNGQWSEPPKCLDSEGKCGFPPPIENGDIISFPLPTYAQGSTV
EYQCQAFYELRGDKYIRCRNGQWSEPPKCLEACVISEEMMEKHNIKLKWKYDKKIYLKTN
DTVEFTCKRGYTEKTPRATFRTTCQEGKLKYPSCENNHNTDIK
Download sequence
Identical sequences G3SME6
ENSLAFP00000000682 ENSLAFP00000000682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]