SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001024 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001024
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-33
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 189-357
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-24
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001024   Gene: ENSLAFG00000001209   Transcript: ENSLAFT00000001209
Sequence length 379
Comment pep:novel supercontig:loxAfr3:scaffold_2:86735494:86757224:1 gene:ENSLAFG00000001209 transcript:ENSLAFT00000001209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIFLNTLKYLQTHEYLLDVDLWRLFANLEELSQTSFGFVNSLFGIIKDYVDTPETAPSMD
FISVLTKYFRGSLCQSHQTYCLNYTAAVFYLENLRQRDDFGIYLKCCEQNEQCRRLHLPE
LLVAPLHRLTRYPLLLKNIWKRSTDSTEKVMIYSIKENVEKSIRDLEGKVKWLDNFQTLR
HLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTSRHLIYEGKLSLAESTRFLD
VYLFLFDDFLLVTKTKRNKKKSGNSDAGLMCPSLTAELQTVIKEGGSCTVVDQPIPLDRL
VVKNIDPLHVSVLGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMTQITAAISCFMK
SLETKKISLFTLPAESSEI
Download sequence
Identical sequences G3SN68
ENSLAFP00000001024 ENSLAFP00000001024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]