SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001163 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001163
Domain Number 1 Region: 110-319
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 330-453
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001163   Gene: ENSLAFG00000001382   Transcript: ENSLAFT00000001381
Sequence length 530
Comment pep:novel supercontig:loxAfr3:scaffold_12:10288639:10492059:1 gene:ENSLAFG00000001382 transcript:ENSLAFT00000001381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSERPMVWCCFFVHAQRKRKQSAQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPP
VKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQ
MLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLI
PLHEDLLRQLRDIRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRV
QDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINII
QGIVAEINTKTGESECRYYKERLLYLEDGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLF
QEVLVITRAITHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFF
RVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCASGQAGVLDSEGPFLNPATGS
REPQGETRLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHVES
Download sequence
Identical sequences G3SNH1
ENSLAFP00000001163 ENSLAFP00000001163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]