SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001447 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001447
Domain Number 1 Region: 1393-1683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-71
Family Protein kinases, catalytic subunit 0.00000105
Further Details:      
 
Domain Number 2 Region: 2-176
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-51
Family DBL homology domain (DH-domain) 0.0000000173
Further Details:      
 
Domain Number 3 Region: 667-832
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-38
Family DBL homology domain (DH-domain) 0.0000405
Further Details:      
 
Domain Number 4 Region: 185-303
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-33
Family Pleckstrin-homology domain (PH domain) 0.0000026
Further Details:      
 
Domain Number 5 Region: 833-950
Classification Level Classification E-value
Superfamily PH domain-like 1.58e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 1220-1382
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-24
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 1040-1103
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000018
Family SH3-domain 0.0000318
Further Details:      
 
Domain Number 8 Region: 362-427
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000326
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001447   Gene: ENSLAFG00000001729   Transcript: ENSLAFT00000001733
Sequence length 1705
Comment pep:novel supercontig:loxAfr3:scaffold_25:19680380:19966678:-1 gene:ENSLAFG00000001729 transcript:ENSLAFT00000001733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIMAELLQTEKAYVRDLHECMETYLWEMTSGVEEIPSGILNKEHIIFGNIQEIYDFHNNI
FLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGL
ANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLE
GFEENLAVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYK
NKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERI
IHLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGDGSSQPDTISIASRTSQNTVDSDK
LSGGCELTVVLQDFSAGHSGELTIQVGQTVELLERPSERLGWCLVRTTERSPPQEGLVPS
SALCISHSRSSVEMDSFFPLVKDAYSHSSSENGGKSESVANLQAQPSLNSIHSSPGPKRS
TNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSADEKSK
KGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAARQASTDVPTAADLVSAIEKLV
KSKLSLEGGSYRGSLKDPAGCLNEGVTPPTPPRNLEEEQKAKALRGRIFVCHSAVETAKA
FSIKLTQTVRAGFMKRIEEKGAPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQD
RLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFEEVKQDINQRLTLSDFLIKPIQR
ITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGK
LLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVL
EENVDNDPCKFALMNRETSERVILQAANADIQQAWVQDINQVLETQRDFLNALQSPIEYQ
RKERSTAVMRSQPARAPQASPRPYSSVPMGSEKPPKGSSYNPPLPPLKISTSNGSPGFDY
HQPGDKHEASKQNDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVY
QPASDHSPAAEGWVPGNILAPLTKATAAAENSDGSIKKSCSWHTLRMRKRAEVENTGKNE
ATGPRKPKDILGNKVSVKEANSSEESECDDLDPNTSMEILNPNFIQEVAPEFLVPLVDVT
CLLGDTVTLQCKVCGRPKPTITWKGPDQNILDTNNSSATYSVSSCDSGEITLKICNLMPQ
DSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLPPSSTGNCTIS
GYTVEYREEGSQVWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSEFVR
LPEYDAAADGATISWKDNFDSAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKK
KEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVA
FYIRDIMEALQYLHSCRVAHLDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLL
GNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPH
EYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSYSKIPLDTSRLACFIER
RKHQNDVRPVPNVKSYIVNRVNQGT
Download sequence
Identical sequences G3SP50
ENSLAFP00000001447 ENSLAFP00000001447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]