SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001601 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001601
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.45e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000597
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-35
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-32
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-20
Family First domain of FERM 0.0029
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001601   Gene: ENSLAFG00000001914   Transcript: ENSLAFT00000001915
Sequence length 913
Comment pep:novel supercontig:loxAfr3:scaffold_6:50224915:50324356:1 gene:ENSLAFG00000001914 transcript:ENSLAFT00000001915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKDKTRSEVICSVHFLNGLVQTFKVNKQDTGQVLLDMVYN
YLGLTEKEYFGLQHGDDSADSARWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLICPLNSAVVLASYAVQSHFGDYNASIHHSGYLSDHQFIPYQ
NDDFLTKVASLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
IALYRKYICTSFYPWANILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKARHSSADNIVNEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPYRESTSETNPAQSCLTQKSSSSVSPSSNAPSSCSPDGVDQQFLED
YHRVTKGGSTEDASQYYCDKNDNGDGYLLLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKATRESHTRELALVIRRKVVH
SFADTKSEDELNPFFPETIFPVCPEGGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTSRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVAEHGGFHIRCQSEDCT
IAYVFREMLVTNSKTGEEHRVTHLQYVAWPDHGVPDDSSDFLEFVNYMRSLRVDNEPVLV
HCSAGIGRTGVLVTMETAMCLIEKNLPVSPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLNPS
Download sequence
Identical sequences G3SPH1
ENSLAFP00000001601 XP_003407859.1.64505 ENSLAFP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]