SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002428 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002428
Domain Number 1 Region: 147-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-100
Family Protein kinases, catalytic subunit 0.0000000000174
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 2.23e-24
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002428   Gene: ENSLAFG00000002907   Transcript: ENSLAFT00000002907
Sequence length 481
Comment pep:novel supercontig:loxAfr3:scaffold_99:3387917:3420581:-1 gene:ENSLAFG00000002907 transcript:ENSLAFT00000002907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKRERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DFKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQR
KLLPPFKPQVTSEIDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences G3SRC6
ENSLAFP00000002428 XP_003420826.1.64505 ENSLAFP00000002428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]