SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003599 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003599
Domain Number 1 Region: 418-570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-25
Family SPRY domain 0.01
Further Details:      
 
Domain Number 2 Region: 4-78
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-17
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 168-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000901
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003599   Gene: ENSLAFG00000004318   Transcript: ENSLAFT00000004315
Sequence length 636
Comment pep:novel supercontig:loxAfr3:scaffold_49:6681264:6685317:1 gene:ENSLAFG00000004318 transcript:ENSLAFT00000004315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGVGGAGGPGSTARCPLCQEP
FPDGLQLRKNHTLAELLQLRLGSGPGKGPAPGLAPEPSAPSAPPNAPEPSAPCAPESWPA
TEELVRCDACPEGAALPAAFSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLC
PRHLRPLERYCRAERVCLCEACAVQEHRGHELVPLEQERALQEAEQPKVLSAVEDRMDEL
GAGIAQSRRTVALIKSAAVAERERVNRLFAEAEVTLQRFQAEVLGFIEEGETTMLGRSQG
DLRRQEEQRSRLSRARHNLSQVPEADSVGFLQELLALRLALEEGCGPGSGPPRELSFTKS
SQAVQTVKELLAAACASQWEELQGLGSDEDGLQKMGPEAEADFQDPDSTGRLESEAPRDY
FLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGALDRGTY
YWEVEIIEGWVSMGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPQ
PFSPTVGICLEYADRALAFYAVRDGKMNLLRRLKASRPRRSGAPALPIDPFQSRVDSHFM
GLFTRRLKPAFFLESVDAHLQIGPLKKSSISVLKRR
Download sequence
Identical sequences G3SU13
ENSLAFP00000003599 ENSLAFP00000003599 XP_003417301.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]