SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004296 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004296
Domain Number 1 Region: 151-274
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-33
Family C-type lectin domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004296   Gene: ENSLAFG00000005130   Transcript: ENSLAFT00000005130
Sequence length 277
Comment pep:novel supercontig:loxAfr3:scaffold_8:65376042:65428198:1 gene:ENSLAFG00000005130 transcript:ENSLAFT00000005130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFGALLRRNQFILLVLFLLHIQSLGLDMDSHPTTDVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGHVGAKGIKGELGDIGDQGNIGKTGPIGKKGDKGEKGLPGIPGGKGKAGTVCD
CGRYRKVVGQLDISVARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEGEPS
DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK
Download sequence
Identical sequences G3SVM1
ENSLAFP00000004296 XP_003408206.1.64505 ENSLAFP00000004296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]