SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005365 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005365
Domain Number 1 Region: 66-207
Classification Level Classification E-value
Superfamily L domain-like 3.21e-35
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000005365
Domain Number - Region: 331-548
Classification Level Classification E-value
Superfamily NHL repeat 0.000732
Family NHL repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005365   Gene: ENSLAFG00000006390   Transcript: ENSLAFT00000006390
Sequence length 557
Comment pep:novel supercontig:loxAfr3:scaffold_10:24758796:24805131:-1 gene:ENSLAFG00000006390 transcript:ENSLAFT00000006390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAERSQRMGNACVPLKRIAYFLCLLSALLLTEGKKPTKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLDHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
QLFGGSHIYKRDGFANKFIKIQDIEILKIRKPNDIETFNIENNWYFVVADSSKAGFTTIY
KWNGNGFYSHQSLHAWYRDTDVEYLEIARTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGASFQDIQRMPSRGSMVFQ
PLQINNYQYAILGSDYSFTQVYNWDADKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
FKGNTQIYKHVIVDLSA
Download sequence
Identical sequences G3SY33
ENSLAFP00000005365 XP_003409275.1.64505 ENSLAFP00000005365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]