SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005514 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005514
Domain Number 1 Region: 314-492,522-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.83e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 132-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000842
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 24-144
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005514   Gene: ENSLAFG00000006568   Transcript: ENSLAFT00000006569
Sequence length 960
Comment pep:novel supercontig:loxAfr3:scaffold_15:51947686:51971601:1 gene:ENSLAFG00000006568 transcript:ENSLAFT00000006569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVLGVEAQLTCASLSLPGGSANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRY
AGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDGA
NTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQIC
YYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADDAEVEIQVKPT
CKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNYS
ERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPVGGTAG
VGSGSQDSFSDHFTLSFWMKHGVTPSKNKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAF
LYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPALIHDNGLIHP
PRREPALMIGACWTEEKSKEKEKGGDNSMDPAQVPALGDPLPIHHYFHGYLAGFSVRSGR
LESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYM
NTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFVRPAM
DFEGPEGVPLFPDLQVTCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDD
LDPERENLLLDVASLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLQHGAALYAR
KFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLA
SSHRNSMVPSAATLIIVVCVGFLVLMVILGLVRIHSLHRRVSGAGSTPGTSSDPKDPDLF
WDDSALTIIVNPMESYQNRQVCVAGAAGGQQEDEDSSDSEAADSPSSDERRIIETPPHRY
Download sequence
Identical sequences G3SYE7
ENSLAFP00000005514 ENSLAFP00000005514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]