SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005839 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005839
Domain Number 1 Region: 712-788,822-911
Classification Level Classification E-value
Superfamily RUN domain-like 7.59e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1071-1245
Classification Level Classification E-value
Superfamily RUN domain-like 2.48e-25
Family RUN domain 0.016
Further Details:      
 
Domain Number 3 Region: 919-1016
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 9.46e-19
Family Lipoxigenase N-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000005839
Domain Number - Region: 600-671
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.036
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005839   Gene: ENSLAFG00000006952   Transcript: ENSLAFT00000006952
Sequence length 1252
Comment pep:novel supercontig:loxAfr3:scaffold_21:40422119:40494235:1 gene:ENSLAFG00000006952 transcript:ENSLAFT00000006952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCQYIQASKARDRASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQDAVG
MLCMPKGLAFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHM
HNAEYDVLHTLPVDGRDESVMEDGEGTPGTKLQRFNSYDISRDTLYVSKCICLITPMSFM
KACRSVLEQLHQAVTSPQPPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPVICQRPST
NELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQ
WQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPE
DLPQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRLRASDLVSDKRNGNIAGSP
LHSYELLKENETIARLQALVKRTGVSLEKLEVREDPSSNKDLKVQCDEEEFRIYQLNIQI
REVFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFL
ETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDDAE
KAIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLSTGPVSNKWTKRNAPAQW
RRKDRQKQHTEHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLK
ECRNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSA
LWSHLLHYQENRQRKLTSGSLSTSGILLDSERRKSDASSVMSPLRISLIQDMRHIQNIGE
IKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLS
FNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVL
EMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGS
LERVLVGELLTSQPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAV
NGIVKHFHKPEKERGSLTLLLCGECGLVSALEQAFQHGFKSPRLFKNVFIWDFLVEKAQT
YYETLEQNDVVPEENWHTRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWI
ALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKGIDI
Download sequence
Identical sequences G3SZ66
ENSLAFP00000005839 ENSLAFP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]