SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006312 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006312
Domain Number 1 Region: 280-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-44
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 2.14e-18
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000931
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006312   Gene: ENSLAFG00000026112   Transcript: ENSLAFT00000007506
Sequence length 451
Comment pep:novel supercontig:loxAfr3:scaffold_62:13356912:13379493:-1 gene:ENSLAFG00000026112 transcript:ENSLAFT00000007506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPRKMDSAFQKELTCFICLKYLTDPVTIGCGHSFCQACVCLSWEEAKIPARCPICRNTS
EQTEFRTNTLLKNLVSLARQASLCQFLSSEEQMCGTHKETKKMFCEESKNLLCLLCSNSQ
EHEAHSHCSIECAVEEYREKLIKEMRSLWKNIQKNQRNLNEESKITNLWRYYVCLLSEII
SSEYQKLHPILLEEEKQHLEGLKNEGKKILQQLKKSEATMVQKGRHLREMYEELMNMCHK
SDVELLQDLGDILTRSESVQLDMPQPVNPALSARPITGLIDRFRQFRVEISFRYEISSQN
IMVFDDVRSLRLRRDLQEVPFPSRRSQYFAAWGDQAFTSGKHYWEIDVDDSWDWAVGVCK
DTWLRKNGSLVESENVFLLLCVKDVNRYNLLTTSPVFPQYIEKPLGRVGVYIDFDSRSMS
FVNVAKSSLIWRYPACSFNYPLRPFFCTGHT
Download sequence
Identical sequences G3T050
ENSLAFP00000006312 ENSLAFP00000006312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]