SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006466 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000006466
Domain Number - Region: 601-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006466   Gene: ENSLAFG00000007693   Transcript: ENSLAFT00000007693
Sequence length 889
Comment pep:novel supercontig:loxAfr3:scaffold_6:64497633:64517265:-1 gene:ENSLAFG00000007693 transcript:ENSLAFT00000007693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPRPPLESLTLAWPPSPPLPVFHTFSQIPVQPLSQAHSQCLPKPLAQPLPLLQSSSQPR
LPCHPLSLFKPQCPAQPNPLFQPLPSSPCIPKSLPLPVPLSHTLPLSQPRLRTGLQLPPA
LLLLLLFSVLGPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIF
KEQGGTFGDHCPDQSVTVYFRSGAPPVINPLHTHFPGDTAVPGVFSLNLSWTLPNRTSGI
FNVSSPLPGDWFLAAHLPQAHGHISVKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQ
TLSSHNRSALYKVFVPSFTYRVSAQLVCVGGHGTSTCPLTLRLRPKAPPLHNSSSVTCGG
TSACQLELALPPWGHWVYVRVETPPRGPGRTVRFQLCVRLQECPQPSLSRALVPGAAMNM
PQSLGNQALPPEPPSLGALADGPGATSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVSL
PPERPAVFSLRLLPVLDSGGVLTLELQLNASSLHQENVTVFGCLTHEVPLSLGDAAVTCS
KEALAGFLLSVSAISRVARLRIPFPQTGTWFLTLRSLCGVGPQFVRCRNATAEVRLRTFL
SPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSN
LMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSL
MSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTV
RSVRRRHCYPPTWRRWLFYLCPGSLIAGSAILLYAFVETRDNYFYIHSIWHMLIAGSVGF
LLPPRAKTDHRVPSGSRARGCGYQLCINEQEELGLVGPGGAAVSSICAS
Download sequence
Identical sequences G3U7G3
ENSLAFP00000006466 ENSLAFP00000023771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]