SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006570 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006570
Domain Number 1 Region: 141-430
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-87
Family Nuclear receptor ligand-binding domain 0.000000000323
Further Details:      
 
Domain Number 2 Region: 37-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.54e-27
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006570   Gene: ENSLAFG00000007829   Transcript: ENSLAFT00000007827
Sequence length 433
Comment pep:novel supercontig:loxAfr3:scaffold_25:25145922:25158064:-1 gene:ENSLAFG00000007829 transcript:ENSLAFT00000007827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPEERWKHADLVYNEEADSASGNPTISADEENGGPQICRVCGDKATGYHFNVMTCEGCK
GFFRRAIKRNKRLRCCFRKGTCEITPKTRRQCQACRLQKCLESGMKKEMIMSDEAVEQRR
ALIKRRKREQAHTQPPGAKGLTQEQWTMIGELMDAQIKTFDTTFSHFKNFRLPEVLRSGR
EAPESLQALSGEEDAKWRQIRKDMMSSVKVSVQLRGEDGSVWNYKPPVNGEGKEIFSLLP
HIADVSTYMFKGIINFAKVISCFRDLPIEDQISLLKGATFELYQLRSNTVFNAETGTWEC
GRLSYCLEDPAGGLQQLLLEPVLKFHYMLKKLQLHSEEYVLMQAISLFSPDRPGVVQRRV
VDQLQERFAITLKAYIDYKRPQPAHRFLFLKIMAMLTELRSISAQHTQRLLRIQDIHPFA
TPLMQELFSVTDG
Download sequence
Identical sequences G3T0Q3
ENSLAFP00000006570 ENSLAFP00000006570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]