SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006793 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006793
Domain Number 1 Region: 881-1182
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000987
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-30
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-29
Family Second domain of FERM 0.00043
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-20
Family First domain of FERM 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006793   Gene: ENSLAFG00000008102   Transcript: ENSLAFT00000008103
Sequence length 1186
Comment pep:novel supercontig:loxAfr3:scaffold_74:1673030:1805783:-1 gene:ENSLAFG00000008102 transcript:ENSLAFT00000008103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWYLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAHEHKAHSGILPAEAELMYINQVERLEGFGQESFPVKDNHGNSVHLGIFFMGIF
VRNRIGRQAVIYRWHDIGNISHNKSTILVESISKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSDSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYPDTHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSINSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVVHTDSQSQSLRNLNIINTHAYNQP
GDLVYSQPEMRERHPYTVPYGLQGGYSNKPISPSDHVSPKNHMVPSKPGASAISHTVSTP
ELANMQLQSSQNYNTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTTNKRHSLEVMNSMVRGMEAMTLKS
LNLPMARCNTLREQGPPEDGPGGHEVHQLPQYHHKKTFSDATMLVHSSESEEEEEAAEPV
PQIPVVREKVEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQVSLPSAIARARVL
RHGPAKAISVSRADQLVVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSII
EREMMIRNLEKQKMAGLEVQKRPLMLAALNGLSVARVSGREESRIDATRLHIDERFRTLK
KKLEEGMVFTEYEQIPKKKANGVFSTAALPENAERNRIREVVPYEENRVELIPTKENNTG
YINASHIKVVVGGAEWHYVATQGPLPHTCHDFWQMVWEQGANVIAMVTTEEEGGRTKSHR
YWPKLGSKHSSATYGKFKVITKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDHG
CPEDVQGFLSYLEEIQSVRRHTNSMLEGAKNRLPPIVVHCSAGVGRTGVVILSELMVYCL
EHNEKVEVPMMLRLLREQRVFMVQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences G3T171
ENSLAFP00000006793 ENSLAFP00000006793 XP_003419913.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]