SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007128 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007128
Domain Number 1 Region: 292-402
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000837
Family Second domain of FERM 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000007128
Domain Number - Region: 36-252
Classification Level Classification E-value
Superfamily ARM repeat 0.00662
Family GUN4-associated domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007128   Gene: ENSLAFG00000008488   Transcript: ENSLAFT00000008490
Sequence length 504
Comment pep:novel supercontig:loxAfr3:scaffold_49:6898526:6903153:-1 gene:ENSLAFG00000008488 transcript:ENSLAFT00000008490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEAPSLHPSAGSLSTYSHNYSMQEFALRFFREPRTLLHSTDGDAKVKATDSLVQYTKVP
IQESLISFSDEDKNKQAVESFRALMQFMGDQSKPRGKDEVELLYELLKLCREESLRDEIY
CQVIKQVTEHPQPEHCTRGWKFLSLLTGFFPPSTTLMPYVTKFLQGAGLSQELACSSQEH
LQRTVKYGGRQRLPMPGEIKAFLKGQEVHMLLIHLPGGVDYRTNIQMFTVAAEVLEELCS
HMGVADPQEVQEFALFLIRGEGELVRPLRPFEYLNSVMVDQDLSLHSWRLGWETPLHFDH
PTYICIHYSQVLWDYLQGKLLVSAQADAQLAHLAALQHLSRNTKDPPTERDLLLYVPKQL
QRQLNMATIKRLMDQELRQLQRHSLQDAQISFIEAVSQLPLFGYTVYVVLRVSQLALPGP
GLLGLNRQHLILMDSSSQKLYCSVALHEIQRLRLLSPREEGGAPGLELNYGSVHSPQTIW
FELPQAQELQQTIAFLLDSSTSTP
Download sequence
Identical sequences G3T1X6
ENSLAFP00000007128 ENSLAFP00000007128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]