SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007179 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007179
Domain Number 1 Region: 608-754
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.02e-46
Family Toll/Interleukin receptor TIR domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 34-166,352-545
Classification Level Classification E-value
Superfamily L domain-like 1.55e-33
Family Ngr ectodomain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007179   Gene: ENSLAFG00000008549   Transcript: ENSLAFT00000008548
Sequence length 771
Comment pep:novel supercontig:loxAfr3:scaffold_18:41598861:41601507:-1 gene:ENSLAFG00000008549 transcript:ENSLAFT00000008548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKASSGIFHFAVVFMLTLEIRIQLSVESELVVDRSKKNLTHVPKDLTLKTTILDASQNY
ISELQASDILSLSKLRILILSHNRIQYLDISVFKFNQELEYLDLSHNKLYKISCYPTVNL
KHLDLSFNEFDVLPICKEFGNMSQLDFLGLSATQLQKSSWLPIAHLNISKVLLVLGELYG
QKEDPESLQDLNTKSLHIVFPTQKKFHFVLDVAASTAVSLELSNIKYVPDDNEYSYFMNV
LLRLQKNPRLLDLTLNNIETTWNSFFKILQVVWHTTIEHFSISNVELTGELDHQDFNYSD
TSVKTLSIHQVFSYVYHFQQGYVYKILSNMKIQNFTITGTRMMHMFCPLQISPLVYLNLS
NNLLTDEVFKNCTSLTALKTLILQMNQFKKLVNIVNMTKDMKSLQQLDISQNSLRYENEG
NCFWTKSLLILNMSSNILTDSVFRCIPPSVTVLDLHHNRIVSIPQDVTSLEALEELNVAF
NYLTDLPGCGTFSSLSVLIIDYNLVSRELREFIKNIGQISSEVVEDWPESYKCAYPDSYK
GTQLQNFHMSQLSCNTTLLIVTIGVIVLFLAVIVTFLCIYMDLPWYLRMVCQWTQARHRA
RNMSLKELQKNLQFHAFISYSGHDSVWVKNELLPNLEKEDIRICLHERNFVPGKSIVENI
INFIEESYKTIFVLSPNFVQSEWCHYELYFAHHKLFQDASDNLILILLEPIPRYSIPGNY
HKLKSLMAQRTYLEWPKEKNKHGLFWANLRATINIKLIEQSNQENTCLNNS
Download sequence
Identical sequences G3T217
ENSLAFP00000007179 ENSLAFP00000007179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]