SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009231 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009231
Domain Number 1 Region: 179-507
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-67
Family Pancreatic carboxypeptidases 0.00000235
Further Details:      
 
Domain Number 2 Region: 2-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 507-594
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.04e-19
Family Carboxypeptidase regulatory domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009231   Gene: ENSLAFG00000011034   Transcript: ENSLAFT00000011034
Sequence length 620
Comment pep:novel supercontig:loxAfr3:scaffold_72:1370214:1452714:-1 gene:ENSLAFG00000011034 transcript:ENSLAFT00000011034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPLGLETLKVTDFQLHASTTKRYGLGAHRGRLNIQAGINENDFYDGAWCAGRNDLRQWI
EVDARRLTKFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKE
IPVLNELPVPMVARYIRINPQSWLDNGSICMRMEILGCPLPDPNNYYHRRNEMTTTDDLD
FKHHNYKEMRQLMKVVNEMCPNITRIYNIKSHQGLKLYAVEISDNPGEHEVGEPEFHYIA
GAHGNEVLGRELLLLLMQFLCQEYLARNERIVHLVDETRIHILPSLNPDGYEKAYEAGSE
LGGWSLGRWTHEGIDINNNFPDLNTLLWEAEDRQNVPRRVPNHYIAIPEWFLSENATVAA
ETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDMVRSLWKTQEHTPTPDDHVFRWLAYSYA
STHRLMTDARRRVCHTEDFQKEDGTVNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKY
PHESELPEEWENNRESLIVFMEQVHRGIKGTVRDPHGKGIPNAVISVEGVNHDIRTASDG
DYWRLLNPGEYAVTARAEGFTASTKNCMVGYDMGATQCDFMLSKTNLARIREIMKKFGKQ
PVSLPARRLKLRGRKRRQRG
Download sequence
Identical sequences G3UJB6
ENSLAFP00000027924 ENSLAFP00000009231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]