SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009244 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009244
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family Ephrin receptor ligand binding domain 0.000000798
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 5.24e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-20
Family SAM (sterile alpha motif) domain 0.000046
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009244
Domain Number - Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000141
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009244   Gene: ENSLAFG00000011048   Transcript: ENSLAFT00000011048
Sequence length 986
Comment pep:novel supercontig:loxAfr3:scaffold_3:5158224:5320182:1 gene:ENSLAFG00000011048 transcript:ENSLAFT00000011048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYCVLFSFLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADKDAASIPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDV
SYNVVCKKCGAGDPSKCRPCGSGVHFTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIGAFVISRRRSKYSKAKQEADEEKHLSQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITAIT
HQNKILSSFQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences G3T6R8
XP_003406092.1.64505 ENSLAFP00000009244 ENSLAFP00000009244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]