SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009845 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009845
Domain Number 1 Region: 918-1026
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-29
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1049-1158
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-21
Family PDZ domain 0.044
Further Details:      
 
Domain Number 3 Region: 537-644
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-21
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 4 Region: 752-845
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.017
Further Details:      
 
Domain Number 5 Region: 420-539
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-20
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 6 Region: 335-425
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000034
Family First domain of FERM 0.04
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009845
Domain Number - Region: 73-160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000281
Family Protein kinases, catalytic subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009845   Gene: ENSLAFG00000011780   Transcript: ENSLAFT00000011782
Sequence length 1281
Comment pep:novel supercontig:loxAfr3:scaffold_10:68057191:68154315:1 gene:ENSLAFG00000011780 transcript:ENSLAFT00000011782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKSQEASMSPASVTLASAVQVRGEALSEGELWSLLFLAVERLLEDLHDESSDYVVCPWSA
LLSVTGNLSFQDHVSHVEAAPFKAPELLQGQSNDELPDVSQMHVYSLGMTLYWSAGFHVP
PNQPLQLCEPLHSILLTMCEDQPYRRLSLQSVLEACQVHQQEVAIYPAPAALHIRRLVGL
VLGTITEVERRVVEENTPLQQGRSYLLRKRLQQASTPRSLHPSRVSERSTEIQSSLEPCS
SASAHSGCSLFVNSALPAEVPQDLQEGHRFSSGSAFSVASENSRPAAPSQRGFLQRKEKF
SRPEFVRLAGEAPATLHLPGSIAAKKGKCYLALRDLRVVLLSGQCLEVKCDTESTVGAIF
NAITSFEDLGEVTYFGLAYLKGKEFFFLDNETRLCKVAPEGWSTRPQRKTPASVFTLFLR
IKFFVSCVGLLQQSQTRHQFYLQLRRDILEEKLYCNDETLLQLGSLELLIELQVWPKEQV
KEGKAYFQVEDYIPASLIRRMTASRVQLKISEMHCLSPALWGEDAELEFLRVTQQLPEYG
VLVHQVFPEKSQPETEMALGICAKGVIVYEVKNNVRIATLRFGWRETGKISACRKKFTIT
SSITGKKFRVVTDSAKTCRYLLGLCSAQHGFDAQMSSRPCPRVLTDSDHETPVQRASLNP
ARQAQVRPCSEDALFEPRLDEAPRSLQSTSLDGLNVENSKEAGKEGTRGSPSTGPEQLES
ACMTLKPRSSDPVCALPVQNGVPGSQNNRIKTFATKPDCEIVCVTLRRDPRHGFGFVING
GQGVGKTDPGIFISSILPGGPAEKTNKIKTGGQILALNHISLQGFTFSMAARMIQNADNI
ELIISQSEGVCEYAPREEKNGTANPEVFTADSLSHGHQESFPSHAQDQNKKIEKQEMAQA
PSLVARLRPQLSPLPLESIDSSSPSSPSETKASEIYFVELVKEDGTLGFSVTGGINTSVL
LGGIYVKSIIPGGPAAKEGQILQGDRLLQVDGVSLCGLTHEQAVQCLKGSGQVARLVLER
RGPNTVQQCPSANTSMGEGRAAVSLVTTLPGRPMSCVSVTDGRKFEVKLKKNSSGLGFSF
VQMERESCGHLKNDLVRIRRLFPGQPAEKNGAIAAGDIILAVNGKPTEGLVFQEVLHLLR
GAPQEVTLLLCRPPPGALPEIEDGWQTPARSAVEEFTKSTGTDLELSPSLDQEGSPRDGA
SPDTGEGLDLRPESFQKVLWDQDTHLERPWASCSTHPCPQDAHILLYRLKQEMDASPSAT
SLEKEVRQNCYSVCDIRRFER
Download sequence
Identical sequences G3T856
ENSLAFP00000009845 ENSLAFP00000009845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]