SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009889 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009889
Domain Number 1 Region: 167-267
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.01e-28
Family Elongation factor TFIIS domain 2 0.0053
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.01e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0044
Further Details:      
 
Domain Number 3 Region: 289-347
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000794
Family Transcriptional factor domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009889   Gene: ENSLAFG00000011834   Transcript: ENSLAFT00000011833
Sequence length 353
Comment pep:novel supercontig:loxAfr3:scaffold_39:18071443:18072504:-1 gene:ENSLAFG00000011834 transcript:ENSLAFT00000011833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKNQIAARAALIEQLIAKRNFEDIGNHLTELEMIHVTKEHLQETDVVRVVYRVLKHCP
TVTLKKKAKCLLSKWRALYRMTHCKPIDNPQLSPMSGNKEENSGHSHDPSQDEIMDVSSS
NPWPSFQDVAEAIEMIVPANSAVHVVPKEGHCSGCDLTPTGKESSESLVGPTTPLRTKSI
ELLYKALTSSSTDLPKADLWQKFAREIEEHIFALYSGNLKKYKTCIRSKVSNLKNPRNSH
LQQNLLSGTMSPREFAAMTVLEMANQELKDLRAAYTESSIQEHRLPQELDGTPTNKIKCR
RCEKYNCKVTVIARGALFLPSWVRNSNPDEQMMTYVICNECGEQWYHSKWVCL
Download sequence
Identical sequences G3T894
ENSLAFP00000009889 XP_003416092.1.64505 ENSLAFP00000009889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]