SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010709 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010709
Domain Number 1 Region: 174-280
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.48e-33
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.09e-25
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000756
Further Details:      
 
Domain Number 3 Region: 304-347
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.57e-16
Family Transcriptional factor domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010709   Gene: ENSLAFG00000012805   Transcript: ENSLAFT00000012806
Sequence length 349
Comment pep:novel supercontig:loxAfr3:scaffold_34:1492067:1531633:-1 gene:ENSLAFG00000012805 transcript:ENSLAFT00000012806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQEEELLRIAKKLEKMVARKHTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCS
DKEVVSLAKVLIKNWKRLLDSPGLPKGEKGEEREKAKKNEKGHDCSDWKPETGLSPPRKK
RGEEPKDRRDSTDSKSSATSSPKRPSMERSNSSKSKAEAPKTPSSPLTPTFAPSMCLLAP
CYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVR
SRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDELKELRNAMTQEAIREHQMAK
TGGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVC
Download sequence
Identical sequences G3U1F1
ENSLAFP00000010709 ENSLAFP00000021659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]