SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010896 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010896
Domain Number 1 Region: 655-853
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-37
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1016-1193
Classification Level Classification E-value
Superfamily RUN domain-like 1.01e-27
Family RUN domain 0.016
Further Details:      
 
Domain Number 3 Region: 873-958
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.69e-16
Family Lipoxigenase N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010896   Gene: ENSLAFG00000013024   Transcript: ENSLAFT00000013027
Sequence length 1199
Comment pep:novel supercontig:loxAfr3:scaffold_2:20753272:20858610:-1 gene:ENSLAFG00000013024 transcript:ENSLAFT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLCMPKGLSFRTQTDNKDPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTAMQTLYQM
HNAEHYSSVYASSSCSMDSLASSIDEGDTTSLLKLQRYNSYDISRDTLYVSKSICLITPL
PFMQACKKFLIQLYKAVTSQQPPPLPLESYIHNILFEVPLPPPGRSLKFYGVYEPVICQR
PGPSELPLSDYPLREAFELLGLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLF
PFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE
LPEEFPQFPNKVDFIQELSEVLLQFGIPPEGSLHCSESATKLKNLVLKDLVNDKKNGNVS
TNNISMYELLKGNETIARLQALAKRTGVTVEKMDLSASLSEKEKDLKLQCEEAELMDYKL
NVQLREVFANRFTQMFADYEAFVIQTAQDMESWLTNREQMQNFDKASFLSDQPEPYLPFL
SRFIETQMFATFIDNKIMSQWEEKDPLLRVFDSRIEKIRLYNVRAPTMRTSIYQKCSTLK
EAAQSIEQRLMKMDHTAIHPHLLDMKIGQGKYERGFFPKLQSDVLATGPTNNNRWVSRSA
TTQRRKERLRQHSEHIGLDNDLREKYMQEARSLGKNLRQPKLSDLSPAVIAQTNWKFVEG
LLKECRMKTKRMLVEKMGHEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQIKQQ
KCALTSHLLSGPRDFLKTLFQGILFFYTVALGPERRKSDSGIMLPTLRVSLIQDMRHIQN
MSEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYH
LLSLNAVDYFCFTSVFTTIIIPYRSVIIPIKKLSNAITTSNPWICVAGELGDTGVMQIPK
NLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGID
DGSLERILIGELMTTVSDEDLVKQCRTPPQQKSPTSARRLSITSLTGKTTKPNAGQIQEG
IGEAVNNIVKHFHKPEKERGSLTVLLCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFI
ERAVAYFENTDQILDNEDDVLIQKSSCKTFCHYVHAINTAPRSIGKDGKFQILVCLGTRD
RLLPQWIPLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKGVDV
Download sequence
Identical sequences G3TAJ2
ENSLAFP00000010896 ENSLAFP00000010896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]