SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011123 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011123
Domain Number 1 Region: 304-492
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.9e-66
Family Regulator of G-protein signaling, RGS 0.00000781
Further Details:      
 
Domain Number 2 Region: 701-930
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-64
Family DBL homology domain (DH-domain) 0.000000000867
Further Details:      
 
Domain Number 3 Region: 934-1064
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-39
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 
Domain Number 4 Region: 5-83
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-21
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011123   Gene: ENSLAFG00000013288   Transcript: ENSLAFT00000013292
Sequence length 1452
Comment pep:novel supercontig:loxAfr3:scaffold_58:8270460:8331777:1 gene:ENSLAFG00000013288 transcript:ENSLAFT00000013292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSN
HLEVVKLIKSGSYVALTVQGRPPGSPQIPLADPEVEPSVIGHMSPIMSSPHSPGASGNME
RITSPVLVGEENNVVHNQKVEILRKMLQKEQERLQSLQEDYNRTPAQRLLKEIQEAKKHI
PQLQEQLSKATGSAQDGAVFTPSKPLCDAVTVSDVEADPGDGLGRLDSSSGDGSRPSSDN
ADSPRSGLKERIYLEESPDKSEVIPDTDTQSLIGSPSTRITPHIIGAEDDDFGTEHEQIN
GQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRVFLEFH
QFFLDRSAHLKVSVPDEISIDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQK
RSMGLTLAESELTKLDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQAIEEDKSSTMQY
VILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKHSMKKDREGEEKGKRRGFTSILGPPRR
PSRHDNSAICRAMELQKQRHPKHLSTLSSLSPETQDSAKLRQSGIANEGPDIGYLPANPT
SSVVAGTTLSQEGGKENDMGSKQVGEPPTSGDSTDGTPRTPNTVFDFPPPPLDQVQEEEC
EVERAIEHGTPKPFRKFDSIAFRESQSEDEQFENDLETDPPNWQQLVSREVLLELKPCEI
KRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLN
EQMKVVRKRNETSVIDQIGEDLLSWFSGAGEEKLKHAAATFCSNQPFALEMIKSRQKKDS
RFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTERERVKKAADH
CRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPL
VWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLNTVL
VRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPLPE
SPPCEGDNDEEEPSKLKGEHRGISGTGLQSPDRDLGLGSPLMSSKAQARSLGTAEKPEVD
EFLAAERPFAEERHADGALKELGVGYQISIPGPHLPVSEERWALDALRNLGLLKQLLVHQ
LGLTERSTQEDWHHFPRSRTASQGVQAESGIQNSENIKAYHPGAPRDSVVLASHDSQAGN
IVVMDHMNMTPEMPSPEPEGGLDESGEHFFDAREAHSDDNPSEGDGAIKKEEKDVHSRIS
GNYFILDGYETVQESSTDEEVVSSLPLQPTAGIPSTDSTYQQQHSPQDAHSDGASSPFTP
EFLVQQRWGAMEDSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLKKVEESYTILCQRLA
GSALTDKHSDKS
Download sequence
Identical sequences G3TB17
ENSLAFP00000011123 ENSLAFP00000011123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]