SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011535 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011535
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-35
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 3 Region: 256-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-34
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011535   Gene: ENSLAFG00000013775   Transcript: ENSLAFT00000013777
Sequence length 398
Comment pep:novel supercontig:loxAfr3:scaffold_17:42452162:42463768:1 gene:ENSLAFG00000013775 transcript:ENSLAFT00000013777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVLGSCLLLAVALLGPGPSAQAMKGVKCGGVLSAPSGNFSSPNFPRLYPYNIECNWLI
VVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASGDKGNLLGRFCGQVPPPPFSSSWHV
MLVVFHSDKHVASHGFSAAYQKDVCGGVLTGLSGVLTSPEYPNKYPNNVECHWVIRATGP
ATVKLVFMDFQVEGNEDCTYDYVAVFRGPGPAHRHHYCGSAKPPTLVSLDHELQVIFKSD
FNIGGRGFKAYYFSGECQEVYTFMRGNFSSPQYPSSYPNNIRCHWIIRLPPGYRVKVFFL
DLDLEEPNSLTRTCDFDHLVAFDGASEEAPLLGSWCGHHLPPPITSSQNQLLLLLHTDRS
TTRRGFSVAYIGGQLGLGCGRAGGGRSGTGPRSLQSPS
Download sequence
Identical sequences G3TBZ2
ENSLAFP00000011535 ENSLAFP00000011535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]