SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011900 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011900
Domain Number 1 Region: 529-601
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000314
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011900   Gene: ENSLAFG00000014211   Transcript: ENSLAFT00000014211
Sequence length 613
Comment pep:novel supercontig:loxAfr3:scaffold_31:24520782:24527287:1 gene:ENSLAFG00000014211 transcript:ENSLAFT00000014211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVETAADPVTVVVAVEPKAKDEEEEEEESLSPCETVRWAPVGAVAEAGPRAAAFSEEA
SAEEPGVAPASPSGSPDRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQ
RLLRELEDFAFRGCPHVLGYGDPEDPASDEGDGLPGDRPRLWGEDQSEQEKRERLETQRE
KQRELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIRKLDMNLNEDISSL
STEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGAGHCE
CKASGKTGSGYTRTGSSRLPPGNGRAKPEDVKRAQERGLHLMRRALAVLQIFAVSQFGCA
TGHIPQTLWPTGQADRDYCPLLKRLEVSVDRVKQLALRHQPHDHVVTSANLQDLSLRGKD
ELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYY
HAKNGRAYVESPARKLSQSFALPVMGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKA
LVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVD
LAVRQLKNIKDAF
Download sequence
Identical sequences G3TCT3
ENSLAFP00000011900 XP_003414314.1.64505 ENSLAFP00000011900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]