SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012688 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012688
Domain Number 1 Region: 408-802
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.18e-119
Family Oxysterol-binding protein 0.0015
Further Details:      
 
Domain Number 2 Region: 78-185
Classification Level Classification E-value
Superfamily PH domain-like 8.48e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012688   Gene: ENSLAFG00000015154   Transcript: ENSLAFT00000015154
Sequence length 802
Comment pep:novel supercontig:loxAfr3:scaffold_71:10523185:10557595:1 gene:ENSLAFG00000015154 transcript:ENSLAFT00000015154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATELRGMVEPGPAAIAAAGGGTGPPVVGGGGGGRRDAGPGSGAASGTVAAAAAGGPGP
GTGGVASAGPSPAPPAGGSGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAE
MRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVK
MLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESL
KLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLE
ETLEQLAKQHNHLERAFRGATVLPANTPGNAGSAKDQCCSGKGDMSDEDEENEFFDAPEI
ITMPENLGHKRTGSNISGASSDISLDEQYKHQVEETKKEKRTRIPYKPNYSLNLWSIMKN
CIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYS
TTVFRTSKPFNSLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKI
TSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKT
GDKCNLKFVPYSYFSRDVARKVTGEVADPSGKVHFALLGTWDEKMDCFKVQPVIGDNGGD
ARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLME
NGRWDEANAEKQRLEEKQRLARRKREAEAMKATEDGTPYDPYKALWFEQKKDPVTKELTH
IYRGGYWECKEKQDWSSCPDIF
Download sequence
Identical sequences G3TEK7
ENSLAFP00000012688 ENSLAFP00000012688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]