SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013672 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013672
Domain Number 1 Region: 348-488
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-40
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 930-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 7.22e-39
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 3 Region: 636-779
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-38
Family C-type lectin domain 0.000000487
Further Details:      
 
Domain Number 4 Region: 787-923
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 5 Region: 20-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.64e-35
Family Cysteine rich domain 0.000000762
Further Details:      
 
Domain Number 6 Region: 1218-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-34
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 7 Region: 221-344
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-31
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 8 Region: 497-636
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-30
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1086-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-29
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 151-209
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013672   Gene: ENSLAFG00000022148   Transcript: ENSLAFT00000016286
Sequence length 1455
Comment pep:novel supercontig:loxAfr3:scaffold_15:26716897:26802693:-1 gene:ENSLAFG00000022148 transcript:ENSLAFT00000016286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLKVAFVFLFPVFYYETDTRQFLIYNEDHKRCVEALSPSAVQTAACNPDNESQKFRWVS
DSQVMSVAFKLCLGVPSKTDWVAITLYACDSKNEFQKWECKNDTLFGIKGEDLFFNYGNR
QEKNIMLYKGSGLWSRWKIYGTTDDLCSRSYEAMFTLLGNANGATCAFPFKFENKWYADC
TSVGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSESLWNKDPLTSIYYQINSKSALTWHQ
ARKSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSEGSPFRYLN
WLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNPFVIPSERDVPTSC
PSQWWPYAGHCYKIYRGEKKIQRNALTACRKEGGDLASIHSIEEFDFIFSQLGYESNDEL
WIGLNDIKIQMYFEWSDGTPVTFTKWLHGEPSHENNRQEDCVVMKGKDGHWADRACEQPL
DYICKMKAQTQVPAIVEVETGCRKGWKRHGFFCYLIGHTLSTFTEANQTCGNEKAYLTTV
EDRYEQAFLTSFVGLRPERYFWTGLSDIQSKGTFQWTIEEGVQFTHWNADMPGRKAGCVA
MRTGIAGGLWDVLKCDEKAKFVCKHWAEGATRPPEPTTTPEPKCPEDWGTTSKSSLCFKL
FTKGKHDKKTWFESRDFCRALGGDLASINNKEEQQAIWRLITSSSSYHELFWLGLTYGSP
SEGFTWSDGSPVSYEHWAYGEPNNYQNVEFCGELKGDPGMFWNDINCEHLNNWICQIKKG
QTPKPEPTPAPQDNPPVTEDGWVIYKEYQYYFSKEKETMDNAREFCKRNFGDLVSIQSES
EKKFLWKYVNRNDAQSAYFIGLLISLDKKFIWVDGSKVDYVAWATGEPNFANDDENCVAM
YSNSGFWNDINCGYPHAFICQRHNSSINATVLPTTPPVKGGCEQGWKSYNNKCFKIFGFV
EEERKNWQEARKACIGFGGNLVSIRNEKEQAFLTYQMTGSSFNAWIGLNDVNSEHTFLWT
DQRGVYYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSQDAGKWMDDTCDSKRGYICHTLP
NPSLPVSPTTVPSDGFINFGESSYSLIDLKLSWYEAEKYCTLHNSHIGSILDPYSNAFVW
IQMEKLNSPVWIALNSNLTNNEYVWTDKWRVRYTNWAADEPKLKSACVYLDTDGYWKTAY
CNESFYSLCKRSNDTPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTKNWGHASLEC
LRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGMWLWINKNPVSFVNWNAG
DPSGERNDCVTLLASSGFWNNVHCSSYKGYICKRPKKTVVDAEPTRTLMTTKADSRKMDP
SKPSSSVAGIVVIVILLILTGTGLAAYFFYKKRRVQLPQESTFENTLYFNSRSSPGTNDT
KDLMDNIEQNERAAI
Download sequence
Identical sequences G3UMT7
ENSLAFP00000029146 ENSLAFP00000013672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]