SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014855 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014855
Domain Number 1 Region: 196-323
Classification Level Classification E-value
Superfamily C-type lectin-like 6.7e-41
Family C-type lectin domain 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000014855
Domain Number - Region: 66-223
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00136
Family HBL-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014855   Gene: ENSLAFG00000017714   Transcript: ENSLAFT00000017718
Sequence length 329
Comment pep:novel supercontig:loxAfr3:scaffold_27:22689708:22694567:-1 gene:ENSLAFG00000017714 transcript:ENSLAFT00000017718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMTAGEELPCAHFEVDKQNISLWPREPPSKMDRPLALRKPSTLCAVLTFLTLVLVTSILL
QSILYSWLLGTISDVRINAQLLKGRVDNISTEGSEIKRNQGGLKTASVQIQRVNVSLNHV
HSQLLTLETGLEKANAQIQMLTKSWEEVDALNAQIPELKRDLDKASVLNAKVRGLQSSLE
NMGKSLRQQNDILQMVSQGWKYFKGNFYYFSRVQKTWYSAQQFCKSRNSQLTSVTSESEQ
EFLYKTAGGISYWIGLTKAGSEGDWSWVDDTPFNKVQSAKFWIPGEPNNSGYSEHCAHIR
MASLQSWNDASCDNTLPFICKQLYIPSEP
Download sequence
Identical sequences G3TJF3
ENSLAFP00000014855 ENSLAFP00000014855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]