SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014945 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014945
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily PH domain-like 3.16e-17
Family Ran-binding domain 0.035
Further Details:      
 
Domain Number 2 Region: 324-432,513-637
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000422
Family Armadillo repeat 0.04
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000014945
Domain Number - Region: 144-235,286-399
Classification Level Classification E-value
Superfamily ARM repeat 0.0397
Family MIF4G domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014945   Gene: ENSLAFG00000017825   Transcript: ENSLAFT00000017826
Sequence length 822
Comment pep:novel supercontig:loxAfr3:scaffold_52:6394154:6459159:1 gene:ENSLAFG00000017825 transcript:ENSLAFT00000017826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQARDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESE
EERFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQL
FQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRH
REFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFN
KVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKT
LAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINV
IIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPL
LANTSEDKYEKDNIVGSNKNNTVCPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKD
LLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVVNALLDNGTRYN
LLNSAVVELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKL
NSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKSKPEDDFPDSYEKFME
TKKAKESEDKENLPKRTSSGGFKFTFSHSASAANGTNSANSKSVVAPTSPASSNGSSSKT
TGLAASVTASKGSLVGLVDYPDDEEEDEEEETSPRKRPRLGS
Download sequence
Identical sequences G3TJM6
ENSLAFP00000014945 ENSLAFP00000014945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]