SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016190 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016190
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000246
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016190   Gene: ENSLAFG00000020981   Transcript: ENSLAFT00000020908
Sequence length 111
Comment pep:novel supercontig:loxAfr3:scaffold_28:8806780:8880981:1 gene:ENSLAFG00000020981 transcript:ENSLAFT00000020908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVDHEEPCGLNHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSDL
SVIFVVLAVLGTLIIGAFYFLCRKSHLQRASSAPYDISLVETSNTSAQDSE
Download sequence
Identical sequences G3TM85
ENSLAFP00000016190 ENSLAFP00000016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]