SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017844 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017844
Domain Number 1 Region: 29-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.16e-21
Family Pentraxin (pentaxin) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000017844
Domain Number - Region: 2439-2719
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000732
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017844   Gene: ENSLAFG00000021418   Transcript: ENSLAFT00000022733
Sequence length 2784
Comment pep:novel supercontig:loxAfr3:scaffold_89:4936313:5067630:-1 gene:ENSLAFG00000021418 transcript:ENSLAFT00000022733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEHIIFQMLYGLILMASFIFLSDALSLKGKKLDFYERGDTYVILHSTTPELSRFTVCMD
LLFTDDHLSDWIAFSYITNNTFLGREDIDLGLAGDHHRLILYNLGKIFYIHYHLTPFQWH
TVCLMRDGVKGKLELFLNKERLLVTMDQPQNLTPNGTVVLGHFPKNGHSQVKSIVRSFTG
SLYYFQLWDHILENEEFMKCLEGNVVSWEEDAWLINKIIPTVDKRLRCFVSDNITIQGTS
TTVSQQIDLTTPSQITGLKPQKTLYSSTVMSKSIPVFATNYTTISYSNTTSPPLETTTAS
KNFKPSVAEISTLAADTLLTSAAITLPTKSISIITNNNSMKTSNSPSSERTMTTKMAEAI
TSEAFHQTTATDFLYTSGFTNNSVVSKTSATRSQSAITKTTSLFSSVESTSMTTTSWPKH
RSTDIGALPISTTGQVFLAFSTAGTVPWSTVGQTSATSTTIGTALAFPPEPELISTAAPV
DSVFPRNQTASTSARADMEIAFTVHSMTLPARPIETTLALKTAETELTSTNFQDVSSPRV
EDAISTSMPKEASSMALSFRASSPFIGVQSVQTVIDDETTLTVLTPGITLEPTVAETRSW
FTTKSVKTTPKSLSSYNATTEIFNSTHTYTAGWTSETLREGNSVPSPTSGLAWTLPELLD
VSTTRILGTIFTTTLTDRTAMYLSAGMLPPQPISTHSPATPGPVTHMFSLPVNGSAVTSM
MVSNETKVTMPEPSTPARTFSTSMLSDVSTLPSATVTTASMTTLSQTASTTSNNMPTHRD
SILTTSEGTVISVKMTPMTFPSLTETPVPSLRPPTPMTTKVDTTLHSTSSDTVTPSTHTL
TYSMSLPNNIPVVSSTHVISTASTPVATQSASQVAEATVLERSTHALSFLHSLSGGTDAL
SLVTGTTETSVVDETMPSHTSANKFTTSIDIHNSQSSTRLVNTPVPTLLMIGTSTVSSDK
EQVITSLGNTPKTMDTIEMSPSKNYFISYSQGTSSLKMTDIGFSETLKISSHQTYSPSEI
PLGTLPEGNSASSSTSGNTQTTATLTSNNTVDAHISEMSTRLGKTDLPPQALTTTTFLSL
EKESMSAPSVYTPRSVEMIVSPTSVTRPVSFHQDTSFIDTATPRTTRLLNFMNINTTTSH
LPSLRTQTEVTSVSSPISESTQASPESLSLFTTELFNASFPIISTDRITTALSVPNVPTS
LLGKTSMATRIPISQMSSLPINVTAFTSKRIPETPTILMTQSSETTSPGCWKSPVAATSG
PMSEIVLLPVNDSAFSPVVVSSGTSTTAGPFPTLSASITPRTAMTIETSTLDVIPVTYAG
PSAKGTVVSPAFATSEMTKMSSSITPTTFFSLEESTFPSVKTIPTTVKAGIVTPLIGTTV
FSLLSSKNPEAVSSTPTITFSPILSTAQQPSQGDEATTLSLLPGITHSSLTTVSSGTETA
LTNTYSRTVVPENVPSPTPSGNLHTSLNIQVSPSLTSFTGIPGPTKSVKVTTYLSSNTGK
MTSLSENTPLTDELTKSATSINTPISYPPLTPFIATPLSLTSFLYSPHSIETEFSTTKTS
TVSTTHMTEFPILGTAITSSNSESFLKTSWSTLTATDSQFPISTTAHVPTPNNMETATLQ
LVPGSLSIFIAPQTGLVSEDTASKPSIPMSGILSTFGLFESPSLSASSRAIPTTLADIKQ
TFEKTSTSVTPGITLPSKPSSAAAGSTISKAATLPMLIWVSSSFPSGSPLATVSKAPQVI
TSTVEEPKSTFLTSDTTPAHPFTNFTTLPFATVGTILTNPMPTPTGFPASLPVSVKITDD
NAYISTSPRAFPRITVMANSRTVSLLPSFSRMSMSPLTTDHTLSIGSIPLSSPTVTSSWS
SIPAVSVSPTLVLPKPTLDSLPNITTTTSPTNGASFPLISTGVTHPSTATGSSLISSSFE
TTGLNSTPSFLSTETLTSTIAAEYTVSFYNIEMIFSVFDGEPRTPITSVINEFAEYWLNF
IFQDSEFTLANLATQIKSRDMSEEEVTMDRAFLTQREGQGMATISRVPYSCVCQVIIKAN
SSLAPTELINKIKSKIHGNLTYTNFTQDQLTLLVKSEHVAVKKLEPGRCKADETASKFKG
TYKWLLTNPTETAQTRCIKNEDGNATRICSISINTGKSQWEQPKYKQCKLLQELPNKIVD
LANITINDENADDVAGHILNLIHESPHLDKEETKIVVSKVSDISQCDGISVNLTQIILQI
IDAVLGKQNDSASDVHEVSNEILRIIDRAGHKMEFFGNTANLTVARLALAVLRVDHRFEG
MVFSIRSFEEGIDPEIYLSEVPLGKILASIYLPKSLRERIPLNNLQTVLFNFFGQTSLFK
IKNFTKALTTYVVSASISDMSIQNLADPVVITLHHIEGSSSYGQVHCAFWDFGKNGGLGG
WNSSGCTVNETNVNYTICQCDHLTHFGVLMDLSRATVDAVNERILVLITYTGCGISSIFL
GIAIVTYIVFHKLRKDYPSKILINLCTALLMLNMVFLVNSWSASFQKVGLCITTAVALHY
FLLVSLTWMGLEAVHMYFALVKVFNIYIPNYILKFCLVGWGIPAIMVTIILSVKKDLYGT
LSSGTPFCWIKDDSVFYISVVGYFCLIFIMNLSMFCTVIVQLNSMKAQSQKTRRKMILHD
LKGTTSLTFLLGLTWGFAFFAWGPVRIFFLYLFAIFNTLQGLGFLIFVFHCAMKENVREQ
WQIHLCCKWFRLDNSPDVSSRYGLNVGSKQKRLRKTFEHKLLTPSIKSTATNSTFKSVSS
AQGTPSGISFPNDHFDENPFGFFP
Download sequence
Identical sequences G3TQK8
ENSLAFP00000017844 ENSLAFP00000017844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]