SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018099 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018099
Domain Number 1 Region: 38-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-93
Family Integrin alpha N-terminal domain 0.000000000782
Further Details:      
 
Domain Number 2 Region: 784-1014
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-64
Family Integrin domains 0.00000376
Further Details:      
 
Domain Number 3 Region: 484-642
Classification Level Classification E-value
Superfamily Integrin domains 3.35e-44
Family Integrin domains 0.0000157
Further Details:      
 
Domain Number 4 Region: 643-777
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-35
Family Integrin domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018099   Gene: ENSLAFG00000015643   Transcript: ENSLAFT00000027372
Sequence length 1062
Comment pep:novel supercontig:loxAfr3:scaffold_15:29348616:29511646:1 gene:ENSLAFG00000015643 transcript:ENSLAFT00000027372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARARCGLAGSRAQPLAPLWCFSAALGMLWSPVSQAFNLDVERLTVYSGPDDSYFGYAV
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGAAVRAHRGNVVACAPLYHWRTLKPTSEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQVQSVTSSIADIIANYS
FKDILRKLAREKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVTVSDVNNDGMDDILIGAPIFMEREFESNPKEVGRVY
LYLQSSPLIFRDAQVLTGTKVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGKDQQGKVLI
YNGNKDGLNIKPSQILQGAWASQAVPSGFGFTLRGDSDIDKNDYPDLLVGAFGTGKVVVY
RARPVVTVDAQLLLNPVIINLENKTCQIPDSMTSVACFAVTVCASVAGQSISNTIALTAE
VQLDSLKQKGAIKRTLFLDNHQSHLIFPLVIRRQKALQCQDLIVYLRDETEFRDKLSPIN
ISLNYSLDESIFKEGLAVKPILNYYRVNAVSEQAHILVDCGEDNICIPVLKLSARPDKDQ
VIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERSNKGLRPLSCEYKMENVT
RMVVCDLGNPMVAGTNISLGLRFAVPRLEKTNVSINFDLQIRSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHREEEVGPLVEHIYEMHNTGPSTISETLLE
VGWPFSSRGEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAASPEDTSELSAFLRNSTIPH
LVKKRDVPVMELHRQSPAKILNCTNIKCLQISCVVGRLEGGESAVLKIRSRLWAQTFLQR
KNNPYSLASLVSFEVKKMPYKDQPVKLPRGSMAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDTTDREQLTNDKTPDA
Download sequence
Identical sequences G3TFK7
ENSLAFP00000013122 ENSLAFP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]