SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018536 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018536
Domain Number 1 Region: 32-165,348-566
Classification Level Classification E-value
Superfamily L domain-like 3.2e-41
Family Ngr ectodomain-like 0.028
Further Details:      
 
Domain Number 2 Region: 629-773
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-41
Family Toll/Interleukin receptor TIR domain 0.00000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018536   Gene: ENSLAFG00000008544   Transcript: ENSLAFT00000008544
Sequence length 808
Comment pep:novel supercontig:loxAfr3:scaffold_18:41571248:41573674:-1 gene:ENSLAFG00000008544 transcript:ENSLAFT00000008544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLLRNTCIFCSIVISAQGWTPKQPEEGELTTNCSSMSLRRVPEDLTPTTTTLDLSYNLL
FQIQSSDFRSVSNLKILILCHNRIQQLDIKAFEFNKELRYLDLSHNRLKIVTCYSLPGLR
HLDLSFNDFDTVPICEETGNMSHLEILGLSGAKIQKSDFQKIAHLYLNTVILGLRTLSYY
EEGSLPILNTTKLHMVLPKNINFWVLLCDGIKTSKILEMTNIDDKSQFASNETQRNLRLK
NAKTSILLLNEVDLLWDDLLIIFQLVWHTSVEYFQLQNVAFGGNVYLDHNSFDYSNTVMR
AIKLEHVHFRIFYIPQDRVYLLFTKMDIENLTISDAQMPHMIFPNYPMRFQYLNFANNVL
TDALFKKPIHLPHLKTLILKGNQLETFFLVSHFASNTSLQHLDLSQNLLQHENNENCSWP
ETLITMNLSSNKFPDSVFRCLPRSIQILDLNNNKIQTVPKAITHLKSLRELNVAFNFLTD
LPGCSHFRSLSILNIEMNLILSPSREFFQSCREVKILNAGRNPFRCTCELRDFIQLQKNS
EGMLAGWSDSYICEYPLNLKGTQLKDVHLPELSCNTALLIVIIVVMLSLGMTVAFCCLHF
DLLWYIRMLSQWTQTWNRVRKTAQERLKRNVQFHAFISYSEHDSPWVKNELIPNLEKEDG
SVLICLHERNFDPGKSVTENIINCIEKSYTSILVLSPNFVQSEWCHYELYFAHHNLVHEN
YIILILLEHIPLYCIPNRYHKLKALMEEKTCLKWPKDRRKHGLFWANLRAAINISLSETR
DMCELQTFAELNEESRGSTDSLIKTDCL
Download sequence
Identical sequences G3TSH8
ENSLAFP00000018536 ENSLAFP00000018536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]