SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018593 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018593
Domain Number 1 Region: 304-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-28
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-22
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 
Domain Number 3 Region: 127-200
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000217
Family C1 set domains (antibody constant domain-like) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018593   Gene: ENSLAFG00000028547   Transcript: ENSLAFT00000028055
Sequence length 472
Comment pep:novel supercontig:loxAfr3:scaffold_138:337410:343321:1 gene:ENSLAFG00000028547 transcript:ENSLAFT00000028055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAVKGPLEPVVALLGGDATLPCQLSPEQSATHMDIRWYRAQLSPAVLVYQNGQEQGGEQM
LEYRGRTELAEDTIGTGSVSLLIEQIRASDNGQYRCLFKDGDISQEAIVELNVIGLGSAP
HVHMTGLENGGIRVLCSSGGWFPKPKVQWEDMTGVKLPSLSEYQTQDGDGLFHVEASLVV
TDSSMGNVTCSIQNPLSGQEKVSAIFLPEPFFPRMSPWKAALAGTLPVLGLLLIGTSYIG
WREHQAKHREIKKRKQEAAERDQVKNEKRIALEAKETLEADLVRRKALYNEDWKKAQLYP
DWRKEQFQPALVTLKHENFHQNNSDPEEKENCSKETHDISLSNKKGDGNLIILNQKSFTS
GRYFWEVDTGDTDEWALGIYEVHISDNELPKDVPLKKFRVLEKKGCNYRALTCGPKVISQ
EVPVLIEKFPQKIVIFLDYEDSDISFYDMTEGTHIFSFTQVSFSGSLYPYFK
Download sequence
Identical sequences G3TSN5
ENSLAFP00000018593 ENSLAFP00000018593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]