SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019864 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019864
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-89
Family Subtilases 0.000000025
Further Details:      
 
Domain Number 2 Region: 474-615
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-34
Family Proprotein convertase P-domain 0.00086
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000017
Family Prohormone convertase 1 pro-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019864   Gene: ENSLAFG00000003821   Transcript: ENSLAFT00000026221
Sequence length 775
Comment pep:novel supercontig:loxAfr3:scaffold_58:4695966:4722174:-1 gene:ENSLAFG00000003821 transcript:ENSLAFT00000026221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKGRLKVPHLDAPLGLPSCLWLELAGLLLLVPWVMGLPGTGGPEAQGPGGLSWAVHLNS
LEGEGKKETLELQADALAQAAGLLNAGRIGELQGHYLFVQPPGHRQDHQVEAIRQQAEAV
LAKHEAVRWHSEQRLLKRTKRSVHFNDPKFPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKLLRSIVTTDWDLQRGTGCTESHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATQYEDRRADWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKENKAIPLSPRSLEVLWNVSRSDLEMSGLKTLEHVAVTVFITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERAKGTYRLVIRDIGDEPL
QTGILWRWQLTLYGSVWSAVDIRERQRLLQSAMSGKYLHDGFSLPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTIFWTVYYMLEVYLSHRNAASDPVCRSGRCHWPRQSQKAREEGTEL
ESVPLCANKDPDEVETESGGPPTTSGPFAPDLLDQVNWNLSQNVKSALDSPHQHL
Download sequence
Identical sequences G3ST51
ENSLAFP00000003194 ENSLAFP00000019864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]