SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020407 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020407
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000262
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 707-768
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000216
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 775-833
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000341
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 8 Region: 643-694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000236
Family Complement control module/SCR domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020407   Gene: ENSLAFG00000022407   Transcript: ENSLAFT00000027564
Sequence length 927
Comment pep:novel supercontig:loxAfr3:scaffold_65:11279882:11299322:1 gene:ENSLAFG00000022407 transcript:ENSLAFT00000027564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLTEEETLLDPGSETPTVAPEALAELLHGALL
RRGPEMGYLPGSDPGPTLATPPASQTLAAPSLLWATEPGTGPLTTAVTPKGARGAGPTAP
ELLTPPPGTTAPPLPSPASPGPPLSPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLGSTASRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSREEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRSPRGSGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWSGEPPSCMASCGGTIHNATLGH
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGGPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVSTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDSTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPWAIELAWGPNILTCQWGTWSLERCAPLACQKIMTCADPGEITNGHR
TASDAGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGV
PENGYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELL
DNRKLEVTQTTDPSRQLEGGNLALAILLPLGLVIILGSGVYIYYTKLQGKSLFGFSGSHS
YSPITVESDFSNSLYEAGDTREYEVSI
Download sequence
Identical sequences G3TMW1
ENSLAFP00000016497 ENSLAFP00000020407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]