SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020548 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020548
Domain Number 1 Region: 504-664
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-44
Family MAM domain 0.00046
Further Details:      
 
Domain Number 2 Region: 166-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-30
Family MAM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 338-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-29
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 23-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-20
Family MAM domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020548   Gene: ENSLAFG00000005018   Transcript: ENSLAFT00000036718
Sequence length 686
Comment pep:novel supercontig:loxAfr3:scaffold_6:23701027:23784633:-1 gene:ENSLAFG00000005018 transcript:ENSLAFT00000036718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRGVLLVLQALQLAGALNLPAGSCAFEENTCSFDSESAFLPWILNEEGHYIYVDTSFA
KQGEKAVLLSSDLQAEEWSCLRLVYQITTSSEPISDLSRLSLYVRFEDESFDRLLWSANK
ASDSWLIASLDLQNSTKKFKILIEGVLGQGNTASIALFEIKMTTGYCIECDFEENHLCGF
VNRWNPNVNWFVGGGSIRSSPSNLPQDHTFKSELGHYMYVDSVYVKHFQEVAQLISPMTT
APMSGCLSFYYQLQQGNDNAFYVYTRDMTGLYEEIWKTSSLGNAAWNLAEVEFSAPYPME
VIFEVAFNGPKGGYVALDDISFSPVRCQNQTELPFSAVEASCNFEENLCNFYQDKEGPGW
SRVKVKPNMYRVGDHTTGLGSYLLTNTKYTSQPGYIGRLYSPSLPGNLQYCLRFYYAIYG
FSKMSDTLAVYIFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMGLCKTFWD
CGLVALDDITIQLGNCWFPERLPPAPGECTFEQDECVFTQERRNRSSWHRRRGETPTSYT
GPKGDHTTGVGYYMYIEASNMVYGQKARLQSQPLRGVTGKHCLTFFYHMYGAGTGLLSVY
LKKEDNSEESLLWRRSGEQSISWLRALIEYSCERQHQIIFEAIRGVSIRSDIAIDDVKFQ
AGPCAELEDTTQQSSGYSEDLNEIEY
Download sequence
Identical sequences G3SVD8
ENSLAFP00000004201 XP_003407461.1.64505 ENSLAFP00000020548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]