SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021124 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021124
Domain Number 1 Region: 31-188
Classification Level Classification E-value
Superfamily RUN domain-like 6.02e-32
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 796-900
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-20
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021124   Gene: ENSLAFG00000004509   Transcript: ENSLAFT00000032477
Sequence length 1047
Comment pep:novel supercontig:loxAfr3:scaffold_26:6507204:6522863:-1 gene:ENSLAFG00000004509 transcript:ENSLAFT00000032477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPHGRRQRLAAAPGPRRGKRRRGGGGAMEPREVKDRILENISLSVKKLQSYFAACEDETP
AIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNLGRS
RAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFDL
DLDAPYLDLAPYMPDYYKPQYLLDFEDRLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIA
PSSEDYDFGDVFPAVPSVPSTDWEDGDLTDTVSGPRSTASDLTSSKASTKSPTQRHNPFN
EDQGEGMSSSDTTPVHTASLEKEESQALDLPEACTELEVIRVTKKKKIGKKKKTKSDEEA
SPLHPASTQQKCSRPGDGPGHRQDSSDTTLASPLEEGEGPSSAAESSECAELGHMGLLIP
AMKDTSMERLGQPLSKVIDQLNGQLDPSTWHSQAQHPDQSFRTGSPGDTPERPPFCDFSE
GLPAPMDFYRFTIESPSTAASGGGHHDPAGPGQPLHVPGSPAAAGQEEEGGGEGQAPRPL
ENTQGEARELQTQELETQLSLVSKGPVREPEPGTQEALCRLKQDQPSPCLSSAEDSGVDE
GQGSPSEMIHSSEFRVDNNHLLLLMIHVFRENEEQLFKMIQMSTGHMEGNLQLLYVLLTD
CYVYLLRKGATEKPYMVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVTLAE
FFLASLKSAMIKGCREPPYPSILTDATMEKLALAKFVAQESKCEASAVTVRFYGLVHWED
PMDESLGPVPGHFSPLEGAITKEGTLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTD
VIPLLSVNMGGEQCGGCRRSNTTDRPHAFQVILADRPCLELSANSEAEMADWMQHLCQAV
SKGVIPQGVAPSPCIPCCLVITDDCLFTCHEDCQTSFFRSLGTARLADISTACSEPGKEY
CVLEFSQDSQQLLPPWVIYLSCPSELDRFLSALGAAWKTIYQVDLPHKAIQEASTQKKFE
DALSLIHSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences G3SUE3
ENSLAFP00000021124 ENSLAFP00000003763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]