SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021441 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021441
Domain Number 1 Region: 61-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-88
Family Calnexin/calreticulin 0.00000000246
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.3e-59
Family P-domain of calnexin/calreticulin 0.0000000312
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family Calnexin/calreticulin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021441   Gene: ENSLAFG00000000512   Transcript: ENSLAFT00000036117
Sequence length 593
Comment pep:novel supercontig:loxAfr3:scaffold_1:106174176:106187233:1 gene:ENSLAFG00000000512 transcript:ENSLAFT00000036117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTAAVQAHDGHDDDMIDIEDDLDDVLEEVEDSKSKPDTSTPASPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLSDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPEGWLDNEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAVGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEE
RPWLWVVYTLTVALPVFLVILFCCSGKKQPSAVEYKKTDAPQPDVKEEEEEKEEEKHKED
EEEEGEEKLEEKQKSDAEEDGGTASQEEEDRKPKAEEDEILNRSPRNRKPRKE
Download sequence
Identical sequences G3SLU9
XP_003404750.1.64505 ENSLAFP00000000430 ENSLAFP00000021441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]