SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022313 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022313
Domain Number 1 Region: 416-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-21
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 597-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-20
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 710-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 769-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000891
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 836-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000813
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 532-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000129
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 8 Region: 240-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000105
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022313   Gene: ENSLAFG00000013857   Transcript: ENSLAFT00000033661
Sequence length 994
Comment pep:novel supercontig:loxAfr3:scaffold_47:1929313:1952734:-1 gene:ENSLAFG00000013857 transcript:ENSLAFT00000033661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPATLLLLPSLLALLAHGLSSEPPTMGEGQAPGIEETDGELTAAPTPERPERGIHFITT
APTLKLLNHHPLLEEFVQEGLERGEEELRPAQPFQPDPPTPFTPSPLPRLANQDSRPVFT
SPTPATAAAPTQPQSREDPWNLESEPPALLVTAPLPPGPSTAVPTPGLEERPSTIPPGRA
WTLTQEGPGDMGRPWSPEVMSQTTGLRLEGTTATSTASGDDEETTTTTTIVTTTITTVQP
PGPCSWNFSGPEGSLDSPTASNSPPDVGLDCFYYISVYPGYGVEIKVQNISLLEGEMVTV
EGLGGSDPLPLANESFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYRAYLLSCHFP
RRPAYGDVTVTSLHPGGSARFHCATGYQLKGARLLTCLNATQPFWDSQEPVCIAACGGVI
RNATTGRVVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVE
APPVYDSYEVEYLPIEGLLSSGRHFFVELSTDSNGAAAGMALRYEAFQQGHCYEPFVKYG
NFSSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECIDPHEPQWNETEPACRAVCSGEITDS
AGVVLSPNWPEPYGRGQDCIWGVHVEEDKRVMLDVRVLRIGPGDVLTFYDGDDLTARVLG
QYSGPRGHFKLFTSMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGW
KSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPFCQRVTSCHDPGDVEHS
RRLISSPKFPVGATVQYICDQGFVLTGSTILTCHDRQAGSPKWSDRAPKCLLEQFKPCHG
LSAPENGARSPEKQLHPAGTTIHFSCAPGYVLKGQASIKCVPGHPSHWSHPPPTCRAASL
DGFYSGRSLDVAKAPAASRTLDAAHIAAAIFLPLVAMVLLVGGVYFYFFRLQGKSLLQLP
QPHPRPYDRITVESAFDNPTYETGFLSFAGDERI
Download sequence
Identical sequences G3TC53
ENSLAFP00000022313 XP_010594765.1.64505 ENSLAFP00000011609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]