SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022331 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022331
Domain Number 1 Region: 34-223,268-517
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.02e-75
Family Integrin alpha N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 846-1084
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-48
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 517-682
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-31
Family Integrin domains 0.0046
Further Details:      
 
Domain Number 4 Region: 683-835
Classification Level Classification E-value
Superfamily Integrin domains 2.67e-21
Family Integrin domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022331   Gene: ENSLAFG00000026196   Transcript: ENSLAFT00000037098
Sequence length 1180
Comment pep:novel supercontig:loxAfr3:scaffold_2:45071836:45092864:-1 gene:ENSLAFG00000026196 transcript:ENSLAFT00000037098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTRGHDPWGASGLFYLLGSLLAGMFCPGAVAFNLDVMGALRKEGESGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGVDVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHDQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCVQGSADLAY
LDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDPDQLVYKTLDPADRLPGPVGD
LALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVVLSGERL
TSGFGYSLAVADLNNDGWPDLVVGAPYFFERQEELGGAVYVYMNQGGHWADVSPLRLCGS
PDSMFGVSVAILGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVLTPSQVLEGEAVGI
KSFGYSLSGGLDMDGNHYPDLLVGSLADTAVLFRARPVLHVSHEVFIAPRTIDLEQPNCP
GGHSVCVDLRVCFSYIAAPSSYSPIVALNYMIDGDTDRRLRGQVPRVTFLSRNPDDPKHQ
ASGTVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYSLQTLGSGDRLLARGFPSGPI
LNVHQPSTQRAEIHFLKQGCGEDKICQSNLQLVQARFCSRVSDTEFQPLPMDADGMTALF
ALSGQPVIGLELKVTNLPSDPAQPQADGDDAHEALLLVTLPASLDYSGVRALDPAEKPLC
LSNENASHVVCELGNPMKRGAQVTFYLILSTSGITIETTELDVELLLATISEQELHPVSL
RARVFIELPLSITGVAIPQQLFFSGVVRGESAMRSERDVGSKVKYEVTVSNQGQSLNTLG
SAFLNIMWPHEIANGKWLLYPVRVELEGGQGPGQKGFCSPRPNILHLDVYSWDRRRRELG
QPEQQEPREQPEPSASWWPVSSAEKMKNITLDCARGTANCIVFSCPLYSFDRVAVLRVWG
RLWNSTFLEEYSTVKSLEVIVRANITVKSSIKNLLLKDASTVIPVMVYLDPMAVVAEGVP
WWVILLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVPQYHAVKIPREDRQQFKEEKTG
TILRNNWGSPRREGPDAHPILAADGRPELGPDRHPVPATA
Download sequence
Identical sequences G3UJU9
ENSLAFP00000022331 ENSLAFP00000028108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]