SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024184 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024184
Domain Number 1 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family Laminin-type module 0.0000664
Further Details:      
 
Domain Number 2 Region: 723-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 4 Region: 883-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 5 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 6 Region: 446-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 772-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 10 Region: 982-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000024184
Domain Number - Region: 1080-1297
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000249
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 
Domain Number - Region: 99-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00383
Family Galactose-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024184   Gene: ENSLAFG00000016547   Transcript: ENSLAFT00000034967
Sequence length 1608
Comment pep:novel supercontig:loxAfr3:scaffold_16:17229010:17354626:-1 gene:ENSLAFG00000016547 transcript:ENSLAFT00000034967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSERAAPALRARGRLWPLLAVLAAAAAGCVRAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGAPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECGKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECSFDSELYRST
GHGGHCTNCQDNTDGANCERCRENFFRLGSNEVCSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFSCERCKPGF
FHLESSNPRGCTPCFCFGHSSVCTSAVGYSAYSITSTFHTDEDRWRAEQRDGSETSLEWS
SERQDIAVISDSYFPRYFIAPEKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNPYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSVKIRGTYS
ERSAGYLDDVTLASARPGSGVPAPWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCRCRDNTAGPHCEKCGDGYYGDSTMGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CDRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPSPADKCKACACNPYGTVRQQSSCNPV
TGQCECLPHVTGRDCGACEPGFYNLQSGQGCKRCDCHALGSTNGQCDIHNGQCECQPGIT
GQRCERCEVNHFGFGREGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELERLIADLGTGDEVVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNSIEETGNLAEQARTRVEST
ERLIEIATRELEKAKVAVANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADNIVRVA
KTASDTSTEAYNLLLKTLAGENQTAFEIEDLNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVTQLTPVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLRDDMRGKELEV
KNLLEKGKIEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNK
TAAEDALRKIPAINQTISEASEKTREAQLALGNAAADPTEAKNKAHEAEKIASAVKKNAT
SAKAAAERTFAEVTDLDREVSDMLKQLQEAEEELKAKQGDADQDMMMAGMASQAAQEAEI
NARKAKNSITSLLTIINELLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKSSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIHNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences G3U8M6
ENSLAFP00000024184 XP_003410899.1.64505 ENSLAFP00000024184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]