SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024552 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024552
Domain Number 1 Region: 192-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-77
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000767
Family Pleckstrin-homology domain (PH domain) 0.00000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024552   Gene: ENSLAFG00000027344   Transcript: ENSLAFT00000034695
Sequence length 459
Comment pep:novel supercontig:loxAfr3:scaffold_9:82347634:82357176:-1 gene:ENSLAFG00000027344 transcript:ENSLAFT00000034695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQCQLMKTERPRPNTFII
RCLQWTTVIERTFHVETPEEREEEGEAVRRKRAEGLGQRGWSPTCCRNPQLSSVSSVAPF
LWSPVPGGRLQRRPLLGPVQAGLPARVSEPTLGLCLASLSQDCWALHATWGLAHPPESAW
ASVLALFPFQALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEERARFYGAEIVSAL
DYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVL
EDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLLS
GLLKKDPKQRLGGGAEDAKEIMQHRFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEE
FTAQMITITPPDQDDNMECADSERRPHFPQFSYSASGTA
Download sequence
Identical sequences G3U9P4
ENSLAFP00000024552 ENSLAFP00000024552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]