SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026404 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026404
Domain Number 1 Region: 410-764
Classification Level Classification E-value
Superfamily L domain-like 5.89e-55
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 50-404
Classification Level Classification E-value
Superfamily L domain-like 1.32e-41
Family Ngr ectodomain-like 0.035
Further Details:      
 
Domain Number 3 Region: 822-968
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-38
Family Toll/Interleukin receptor TIR domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026404   Gene: ENSLAFG00000025903   Transcript: ENSLAFT00000027084
Sequence length 983
Comment pep:novel supercontig:loxAfr3:scaffold_24:23114393:23117370:-1 gene:ENSLAFG00000025903 transcript:ENSLAFT00000027084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEIFLFSLQQSQNERTIPSKDFFFLTVTLRLEADKMDSEHLQPQLLWTILIGLSLPYLAE
TYGFSKCMQYEFDIHHVFCIQKKITNLINAISDIPGYTTHLNLTQNQIHILPPYTFTNLS
ALVDLRLQWNFIQEIGMGAFWGLKNLTFLSLVENKIKSVNNSFEGLSNLKTLLLSQNKIT
HIHKNAFAPLVKLKHVSLSQNNIKNFYNILEAVQHLPCLEYHDLFSNSIISLDHHPRSLV
SLTHLSLQRNQLTELNFSALLLPNLTTLDVSQNGHQVIQNVSLETLPLLKGLNLSGTLVN
LEALPAKHLQNLREMDLSNQEFRSRHLNLNTVCHLLRNLPILETLVFQKNGADAEGIKYL
SNCTRLLSLDLGKNNDLVYLNDSEFDAMPSLQRMNLNKCQLSFVSNRTWSALQNLEALDL
SYNKFKSFPDFAFSPLWCLQFLFLSRNPITELDNMAFYGLYSLKELNLGGCWIVTIDKYS
LAPFPNLESLHLRNNNIRYLKHKTFQFLKKLKVLILSCNHLEAIEKSAFSGLTNLYKLDL
AYNILSGFYADIFLGLENLEILDLSFNKITYETIRTLKIPPFINLKSLKQLNLEGQMHGI
QVVPTSFFQGLNSLQELLLGKNPMAFLDQLQFDSLTNLTKLDILGTRAEDRNLYLDTSLS
HKLKKLKVLHLENNNIESLTPGMFSGLEGLQVFSLRFNNLKVINQSHLENLKSLMYFDIY
RNKLQCNCDNVWFKNWSINTENVHIPYLWSYTCQQSNTQSLIDFDDNVCNFDLGKVCFFF
AFSLVLITMIFSWFDVKITSSLWYGLYIFKTWCLAKWYKREKDFTYDAFVSFTATDEQWV
YEELVLALEEGGQPTSKLCLHHRDFEPGVDIFENIQNAINTSRKALCVVSSHYLHSEWCR
LEVQLASIKMFYEHEDVIILIFLEEIPNYKLSSYHRFQKLVNRKTFITWPDSAHERPLFR
ARVRNALDNKTVENDNAQLIVAE
Download sequence
Identical sequences G3UEZ6
ENSLAFP00000026404 ENSLAFP00000026404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]