SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028630 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028630
Domain Number 1 Region: 616-763
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.97e-47
Family Toll/Interleukin receptor TIR domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 40-168,374-516
Classification Level Classification E-value
Superfamily L domain-like 1.36e-27
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028630   Gene: ENSLAFG00000032091   Transcript: ENSLAFT00000026325
Sequence length 776
Comment pep:novel supercontig:loxAfr3:scaffold_18:41634770:41637178:-1 gene:ENSLAFG00000032091 transcript:ENSLAFT00000026325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSHCNIMPKDKEPIFKNFNFVCVMALIVGIKIQFSEESEFTVDRSKRGLTQVPKDLPPKT
TVLDMSQNHISELQFSDINFLSGLEVLILSHNRIQQLNFSVFRFNQDLEYLDLSYNQLWT
ISCHPVVSLKHLDLSFNNFDTLPICKEFGNSIQLDFLGLSATKLQQLDLLPIAHLHLSYI
LLDLNGYAVKGNEIESLRILNTKKLHLVFHPNSLFSVQLNISVNKLECLELTNLKLNDEN
CEVLINVLSELTRGPSLLNFTLNHVETTWKCLVTIFQFLWPKPVEYLNIYNLTIIENIRK
EYFTYSKTALKSLKIEHITNRVFLFSQNVLYTVFSEMNILMLTISDTPFIHMLCPQKPST
FKFLNFTHNVFTDSIFENCSTLDRLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNS
LEFNRREENCTWVESIVVLNLSSNILSDSVFRCVPPRVTVLDLHNNRIKNIPKQITKLEA
LKELNIAFNYLTDLPGCGTFTSLSALIIDHNSISRELREFIKNIGQISSEVVEDWPGSYK
CAYPESYKGTQLQNFHMSQLSCNTTLLVVTIGVTMLVLVVTVTFLCMYMDLPWYLRMVCQ
WTQTQHRARNTPLEELQRNLQFHAFISYSEHDSAWVKNELVPCLEKEDIRICLHERNFVP
GKSIIENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHKLFHEGSDNLILILLEPIS
QNSIPSKYHKLKALMAKRTYLEWPTEKSKRGLFWANIRAAFNIKLALVTENNDVNT
Download sequence
Identical sequences G3ULC1
ENSLAFP00000028630 ENSLAFP00000028630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]