SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028661 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028661
Domain Number 1 Region: 41-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-71
Family Lectin leg-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028661   Gene: ENSLAFG00000006630   Transcript: ENSLAFT00000035288
Sequence length 351
Comment pep:novel supercontig:loxAfr3:scaffold_129:1881722:1908595:-1 gene:ENSLAFG00000006630 transcript:ENSLAFT00000035288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWWQRWGPGLAARDGSKMLLLLLFLGSGQGPRHAGAGQTFEYLKREHSLSKPYQGVGTGS
SPLWNLLGSAMVMTQCIRLTPDVQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGD
GLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQETQKRRYSPGVQRVFPYVSA
MVNNGSLSYDHERDGRPTELGGCTAIVRNLNHDTFLVIRYVKRHLTIMMDIDGKHEWRDC
IEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNM
KLPEMTAPLPPLSGLALFLIVFFSLVFSVFAVVIGIILYTKWQEQSRKRFY
Download sequence
Identical sequences G3SYI3
ENSLAFP00000005566 ENSLAFP00000028661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]