SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028694 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028694
Domain Number 1 Region: 498-785
Classification Level Classification E-value
Superfamily L domain-like 1.36e-43
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 38-435
Classification Level Classification E-value
Superfamily L domain-like 9.52e-36
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 873-1029
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-34
Family Toll/Interleukin receptor TIR domain 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028694   Gene: ENSLAFG00000001156   Transcript: ENSLAFT00000001156
Sequence length 1040
Comment pep:novel supercontig:loxAfr3:scaffold_39:18943886:18947035:-1 gene:ENSLAFG00000001156 transcript:ENSLAFT00000001156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFWMRTLNRLFLILLNVVLISKPLGAIWFPKTLPCEVTVDVPKAHVIVDCTDKHLMEIP
GGIPTNATNLTLTINHIPAISPASFRRLEHLVEIDFRCNCVPIRLGPKDNICTRGLQIKP
KSFSRLTSLKALYLDGNQLLEIPQGLPAGLKLLSLEANTIFSIMKENLTELANIEILYLG
QNCYYRNPCNVSFSIEKDAFLSLKNLKVLSLKDNNITAVPTVLPSTLTELYLYNNIITKI
EEHDFNNLNQLQHLDLSGNCPRCYNVPFPCTPCENNSPLQIHVNAFDALLELRVLRLHSN
SLQHVPKRLFQNIKKLEELDLSQNFLAKEIGDAKFLHFLPNLVQLDLSFNYELQVYHAHM
NLSNEFSSLRNLRVLRIKGYVFKELKSLNLFPLQSLPYLEVLDLGTNFIKVADLSIFKQF
ERLKFIDLSMNKISPSGDSSDVGFCPNSRTSVDSYGPQVLETGHYFRYDDYARSCRFKYK
ETPVLPFNENCNMYGQTLDLSSDFQHLSFLKCLNLSGNSISQTLNGSELQPLVELKYLDF
SNNRLDLLHSTAFEGLRNLEVLDISSNGHYFQSEGLTHMLNFTKNLNVLKKLMMNNNGIS
TSSSRTMESNSLKTLEFRGNYLNVFWKDGDNRYLQFFKNLQNLEELDISENSLSFLPPGV
FDGMPPNLKTLSLAKNGLKSFNWGRLEVLKNLETLDLSNNQLKTVPERLANCSSSLKKLI
LKNNQIRRLTKYFLQGAFQLRYLDLSSNKIQIIQKTSFPENVLNNLELLLLHHNRFLCTC
DAVWFVWWVNHTEVTIPYLATDVTCVGPGAHRGQSVVSLDLYTCELDLTNLILYSFSISI
ALFLMVVTTASHLYFWDVWYSYYFCKAKIKGYRRLISPDSCYDAFIVYDTKDPAVTEWVL
DELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKI
AFYLSHQRLIDEKVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCL
KNALATDNHVAYSQVFKETV
Download sequence
Identical sequences G3ULI5
ENSLAFP00000028694 ENSLAFP00000028694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]