SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000238 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000238
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000238   Gene: ENSMLUG00000000263   Transcript: ENSMLUT00000000260
Sequence length 285
Comment pep:putative scaffold:Myoluc2.0:GL429857:3274003:3275630:1 gene:ENSMLUG00000000263 transcript:ENSMLUT00000000260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSDPMELGAPWGPARPEPSPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQIFLVEIEEKELGWCGHLRLGLTALDPAGLAPVPEFSLPDLVSLGHTWVFAITRHHN
RVPREGRPAAEAAVPSRPPALLVEPYLCIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNV
LPPTARRSRLGVLFCPRPDGTADMHIVINGEDMGPSARGLPAAQPLYAVVDVFASTKSVR
LVQLEYGLPSLQTLCRLVIQRSVVHRLAIDGLHLPKGLKDFCKYE
Download sequence
Identical sequences G1NSW4
ENSMLUP00000000238 ENSMLUP00000000238 XP_006091436.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]