SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000296 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000296
Domain Number 1 Region: 13-178
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.94e-19
Family Protein-L-isoaspartyl O-methyltransferase 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000000296
Domain Number - Region: 307-324
Classification Level Classification E-value
Superfamily SOCS box-like 0.0902
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000296   Gene: ENSMLUG00000000328   Transcript: ENSMLUT00000000325
Sequence length 326
Comment pep:putative scaffold:Myoluc2.0:GL430322:543146:552525:1 gene:ENSMLUG00000000328 transcript:ENSMLUT00000000325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLQPGLSFLNLGSGTGYLS
SMVGLILGPFGVNHGVELHPDVIEYAKQKLDFFIRTSDSFDKFDFCEPSFVPGNCLELSP
DCSQYDRVYCGAGVQKEHEDYMKSLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVS
FAPLVQPRRSESGKSRLVQLPPLAVRSLQDLARIAIRGAIKKVIHQEAVSRNGDGLKATP
RFKRRRVRRRRMETIVFLDKEVFASRISNPSEDNSCEGLGEEQREEEEQNPAEMKPEPPV
NFLREKVLSLPLPDPLKYYLLYYRDK
Download sequence
Identical sequences G1NT17
ENSMLUP00000000296 ENSMLUP00000000296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]